SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1ozfB02/189-361 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1ozfB02/189-361
Domain Number 1 Region: 3-170
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2e-40
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000000384
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|1ozfB02/189-361
Sequence length 173
Sequence
MGAAPDDAIDQVAKLIAQAKNPIFLLGLMASQPENSKALRRLLETSHIPVTSTYQAAGAV
NQDNFSRFAGRVGLFNNQAGDRLLQLADLVICIGYSPVEYEPAMWNSGNATLVHIDVLPA
YEERNYTPDVELVGDIAGTLNKLAQNIDHRLVLSPQAAEILRDRQHQRELLDR
Download sequence
Identical sequences cath|current|1ozfB02/189-361 cath|current|1ozhC02/189-361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]