SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|2ftkB02/272-392 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|2ftkB02/272-392
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily Sporulation response regulatory protein Spo0B 3.79e-38
Family Sporulation response regulatory protein Spo0B 0.000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|2ftkB02/272-392
Sequence length 121
Sequence
KTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESEN
HLTVSLQTDHPDRQLILYLDFHGAFADPSAFDDIRQNGYEDVDIMRFEITSHECLIEIGL
D
Download sequence
Identical sequences cath|current|1ixmA02/72-191 cath|current|2ftkA02/72-192 cath|current|2ftkB02/272-392 cath|current|2ftkC02/472-592 cath|current|2ftkD02/672-792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]