SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|2fxb000/1-81 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|2fxb000/1-81
Domain Number 1 Region: 6-68
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.23e-19
Family Single 4Fe-4S cluster ferredoxin 0.0000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cath|current|2fxb000/1-81
Sequence length 81
Sequence
PKYTIVDKETCIACGACGAAAPDIYDYDEDGIAYVTLDDNQGIVEVPDILIDDMMDAFEG
CPTDSIKVADEPFDGDPNKFE
Download sequence
Identical sequences P10245
1iqzA 1iqz_A 1ir0_A 1wtf_A 1wtf_B 1wtf_C 1wtf_D 000005477|e1iqzA1|205.1.1.11|A:1-81 000067021|e1wtfD1|205.1.1.11|D:1-81 000067022|e1wtfC1|205.1.1.11|C:1-81 000067023|e1wtfB1|205.1.1.11|B:1-81 000067024|e1wtfA1|205.1.1.11|A:1-81 000067025|e1ir0A1|205.1.1.11|A:1-81 cath|current|1iqzA00/1-81 cath|current|1ir0A00/1-81 cath|current|1wtfA00/1-81 cath|current|1wtfB00/1-81 cath|current|1wtfC00/1-81 cath|current|1wtfD00/1-81 cath|current|2fxb000/1-81 d1iqza_ d1ir0a_ d1wtfa_ d1wtfb_ d1wtfc_ d1wtfd_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]