SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|2qqgA02/38-93_135-189 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|2qqgA02/38-93_135-189
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 5.14e-30
Family Sir2 family of transcriptional regulators 0.000000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|2qqgA02/38-93_135-189
Sequence length 111
Sequence
SCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPHGSF
AHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLP
Download sequence
Identical sequences cath|current|1q14A02/38-93_135-189 cath|current|1q17A02/38-93_135-189 cath|current|1q17B02/38-93_135-189 cath|current|1q17C02/38-93_135-189 cath|current|1q1aA02/38-93_135-189 cath|current|1szcA02/38-93_135-189 cath|current|1szdA02/38-93_135-189 cath|current|2od2A02/38-93_135-189 cath|current|2od7A02/38-93_135-189 cath|current|2od9A02/38-93_135-189 cath|current|2qqfA02/38-93_135-189 cath|current|2qqgA02/38-93_135-189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]