SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|2wvaE02/188-350 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|2wvaE02/188-350
Domain Number 1 Region: 4-160
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.22e-27
Family Pyruvate oxidase and decarboxylase, middle domain 0.000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|2wvaE02/188-350
Sequence length 163
Sequence
EASDEASLNAAVEETLKFIANRDKVAVLVGSKLRAAGAEEAAVKFADALGGAVATMAAAK
SFFPEENPHYIGTSWGEVSYPGVEKTMKEADAVIALAPVFNDYSTTGWTDIPDPKKLVLA
EPRSVVVNGIRFPSVHLKDYLTRLAQKVSKKTGALDFFKSLNA
Download sequence
Identical sequences cath|current|2wvaA02/188-350 cath|current|2wvaB02/188-350 cath|current|2wvaE02/188-350 cath|current|2wvaF02/188-350 cath|current|2wvaV02/188-350 cath|current|2wvaX02/188-350 cath|current|2wvaY02/188-350 cath|current|2wvaZ02/188-350 cath|current|2wvgA02/188-350 cath|current|2wvgB02/188-350 cath|current|2wvgE02/188-350 cath|current|2wvgF02/188-350 cath|current|2wvhA02/188-350 cath|current|2wvhB02/188-350 cath|current|2wvhE02/188-350 cath|current|2wvhF02/188-350 cath|current|2wvhV02/188-350 cath|current|2wvhX02/188-350 cath|current|2wvhY02/188-350 cath|current|2wvhZ02/188-350 cath|current|3oe1A02/188-350 cath|current|3oe1B02/188-350 cath|current|3oe1C02/188-350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]