SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|3eyaC02/179-333 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|3eyaC02/179-333
Domain Number 1 Region: 4-154
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.28e-41
Family Pyruvate oxidase and decarboxylase, middle domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cath|current|3eyaC02/179-333
Sequence length 155
Sequence
APQPVVTPEEEELRKLAQLLRYSSNIALMCGSGCAGAHKELVEFAGKIKAPIVHALRGKE
HVEYDNPYDVGMTGLIGFSSGFHTMMNADTLVLLGTQFPYRAFYPTDAKIIQIDINPASI
GAHSKVDMALVGDIKSTLRALLPLVEEKADRKFLD
Download sequence
Identical sequences cath|current|3eyaC02/179-333 cath|current|3eyaH02/179-333 cath|current|3eyaI02/179-333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]