SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|3u60F00/7002-7228 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|3u60F00/7002-7228
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily DNA clamp 8.16e-40
Family DNA polymerase processivity factor 0.00000119
Further Details:      
 
Domain Number 2 Region: 111-228
Classification Level Classification E-value
Superfamily DNA clamp 1.4e-38
Family DNA polymerase processivity factor 0.000000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|3u60F00/7002-7228
Sequence length 228
Sequence
XKLSKDTTALLKNFATINSGIXLKSGQFIXTRAVNGTTYAEANISDVIDFDVAIYDLNGF
LGILSLVNDDAEISQSEDGNIKIADARSTIFWPAADPSTVVAPNKPIPFPVASAVTEIKA
EDLQQLLRVSRGLQIDTIAITVKEGKIVINGFNKVEDSALTRVKYSLTLGDYDGENTFNF
IINXANXKXQPGNYKLLLWAKGKQGAAKFEGEHANYVVALEADSTHDF
Download sequence
Identical sequences cath|current|3u5zF00/7002-7228 cath|current|3u5zG00/5002-5228 cath|current|3u5zH00/6002-6228 cath|current|3u5zP00/7002-7228 cath|current|3u5zQ00/5002-5228 cath|current|3u5zR00/6002-6228 cath|current|3u60F00/7002-7228 cath|current|3u60G00/5002-5228 cath|current|3u60H00/6002-6228 cath|current|3u61F00/3002-3222 cath|current|3u61G00/1002-1228 cath|current|3u61H00/2002-2228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]