SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|4bn5K01/122-150_207-247_300-394 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|4bn5K01/122-150_207-247_300-394
Domain Number 1 Region: 6-168
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 7.63e-30
Family Sir2 family of transcriptional regulators 0.0000858
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cath|current|4bn5K01/122-150_207-247_300-394
Sequence length 173
Sequence
DKGKLSLQDVAELIRARACQRVVVMVGAGISTNVTHYFLRLLHDKGLLLRLYTQNIDGLE
RVSGIPASKLVEAQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRD
LVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Download sequence
Identical sequences cath|current|4bn5A01/122-150_207-247_300-394 cath|current|4bn5B01/122-150_207-247_300-394 cath|current|4bn5C01/122-150_207-247_300-394 cath|current|4bn5D01/122-150_207-247_300-393 cath|current|4bn5E01/122-150_207-247_300-394 cath|current|4bn5F01/122-150_207-247_300-394 cath|current|4bn5G01/122-150_207-247_300-394 cath|current|4bn5H01/122-150_207-247_300-394 cath|current|4bn5I01/122-150_207-247_300-394 cath|current|4bn5J01/122-150_207-247_300-394 cath|current|4bn5K01/122-150_207-247_300-394 cath|current|4bn5L01/122-150_207-247_300-394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]