SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d1fqvf1 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1fqvf1
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.83e-33
Family Skp1 dimerisation domain-like 0.00000653
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) d1fqvf1
Sequence length 76
Comment a.157.1.1 (F:85-160) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
Sequence
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrkenqwc
Download sequence
Identical sequences d1fqvb1 d1fqvd1 d1fqvf1 d1fqvh1 d1fqvj1 d1fqvl1 d1fqvn1 d1fqvp1 d2assa2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]