SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d1kqfb1 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1kqfb1
Domain Number 1 Region: 25-241
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.26e-69
Family Ferredoxin domains from multidomain proteins 0.00000000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) d1kqfb1
Sequence length 244
Comment d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]}
Sequence
ametqdiikrsatnsitppsqvrdykaevaklidvstcigckacqvacsewndirdevgh
cvgvydnpadlsakswtvmrfseteqngklewlirkdgcmhcedpgclkacpsagaiiqy
angivdfqsencigcgyciagcpfniprlnkednrvykctlcvdrvsvgqepacvktcpt
gaihfgtkkemlelaeqrvaklkargyehagvynpegvggthvmyvlhhadqpelyhglp
kdpk
Download sequence
Identical sequences d1kqfb1 d1kqgb1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]