SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d2fefa1 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d2fefa1
Domain Number 1 Region: 1-124
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 3.4e-62
Family PA2201 N-terminal domain-like 0.00000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) d2fefa1
Sequence length 124
Comment a.29.11.1 (A:6-129) Hypothetical protein PA2201 {Pseudomonas aeruginosa [TaxId: 287]}
Sequence
ltldnrlaealplwrnlartdraprrnidladwkadwreliaaldrfsrshgyrqpfaaq
ghaalenawawgqaaenastlllkaidrglagaelrsiyletaalwldysrllgaardsl
reqg
Download sequence
Identical sequences 000003659|e2fefA1|633.9.1.1|A:6-129 000054285|e2fefC1|633.9.1.1|C:6-129 000054286|e2fefB1|633.9.1.1|B:6-129 d2fefa1 d2fefb1 d2fefc1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]