SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d2ftkb_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d2ftkb_
Domain Number 1 Region: 5-180
Classification Level Classification E-value
Superfamily Sporulation response regulatory protein Spo0B 1.1e-67
Family Sporulation response regulatory protein Spo0B 0.00000000949
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) d2ftkb_
Sequence length 182
Comment d.123.1.1 (B:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]}
Sequence
nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
nhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieig
ld
Download sequence
Identical sequences d1f51b_ d1f51d_ d1ixmb_ d2ftkb_ d2ftkd_ 1f51_A 1f51_B 1f51_C 1f51_D 1f51A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]