SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d2ftkc_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d2ftkc_
Domain Number 1 Region: 4-179
Classification Level Classification E-value
Superfamily Sporulation response regulatory protein Spo0B 1.1e-67
Family Sporulation response regulatory protein Spo0B 0.00000000949
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) d2ftkc_
Sequence length 181
Comment d.123.1.1 (C:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]}
Sequence
isdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnl
ktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresen
hltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieigl
d
Download sequence
Identical sequences d1f51a_ d1f51c_ d2ftka_ d2ftkc_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]