SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d3iasc2 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d3iasc2
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.38e-34
Family Ferredoxin domains from multidomain proteins 0.0000000658
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) d3iasc2
Sequence length 151
Comment d.58.1.0 (C:96-246) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
Sequence
lsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyglyekyyqkgplelpvyt
rfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfiergvhtfigtmd
fglpsgfsgnitdicpvgalldltarfrarn
Download sequence
Identical sequences d2fug34 d2fugc4 d2fugl4 d2fugu4 d3i9v32 d3i9vc2 d3iam32 d3iamc2 d3ias32 d3iasc2 d3iasl2 d3iasu2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]