SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d4l6pc2 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d4l6pc2
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily DNA clamp 2.36e-35
Family DNA polymerase processivity factor 0.000000561
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) d4l6pc2
Sequence length 126
Comment d.131.1.2 (C:130-255) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
Sequence
elqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfvdme
hpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgflqff
lapkfn
Download sequence
Identical sequences d4l6pc2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]