SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d5bxha1 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d5bxha1
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily POZ domain 3.34e-29
Family Tetramerization domain of potassium channels 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) d5bxha1
Sequence length 103
Comment d.42.1.0 (A:4-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
Sequence
dwltlnvggryftttrstlvnkepdsmlahmfkdkgvwgnkqdhrgaflidrspeyfepi
lnylrhgqlivndginllgvleearffgidsliehlevaikns
Download sequence
Identical sequences 001682079|e5bxhE1|226.1.1.14|E:4-106 d5bxha1 d5bxhb1 d5bxhc1 d5bxhd1 d5bxhe_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]