SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000005923|e1vigA1|327.11.2.1|A:1-71 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000005923|e1vigA1|327.11.2.1|A:1-71
Domain Number 1 Region: 7-69
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.89e-28
Family Eukaryotic type KH-domain (KH-domain type I) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 000005923|e1vigA1|327.11.2.1|A:1-71
Sequence length 71
Sequence
inrmdyveinidhkfhrhligksganinrikdqykvsvrippdseksnliriegdpqgvq
qakrellelas
Download sequence
Identical sequences 1vigA 1vig_A 1vih_A 000005923|e1vigA1|327.11.2.1|A:1-71 000070775|e1vihA1|327.11.2.1|A:1-71 cath|current|1vigA00/6-76 cath|current|1vihA00/6-76 d1viga_ d1viha_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]