SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000006271|e1nn7A1|226.1.1.2|A:1-105 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000006271|e1nn7A1|226.1.1.2|A:1-105
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily POZ domain 1.19e-41
Family Tetramerization domain of potassium channels 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 000006271|e1nn7A1|226.1.1.2|A:1-105
Sequence length 105
Sequence
livlnvsgtrfqtwqdtlerypdtllgsserdffyhpetqqyffdrdpdifrhilnfyrt
gklhyprhecisaydeelaffglipeiigdccyeeykdrrrenae
Download sequence
Identical sequences 1nn7_A 1nn7A 000006271|e1nn7A1|226.1.1.2|A:1-105 cath|current|1nn7A00/42-146 d1nn7a_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]