SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000071940|e1xlnA1|221.1.1.12|A:1-106 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000071940|e1xlnA1|221.1.1.12|A:1-106
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.2e-47
Family 2Fe-2S ferredoxin-related 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 000071940|e1xlnA1|221.1.1.12|A:1-106
Sequence length 106
Sequence
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdrqw
Download sequence
Identical sequences 1oqq_A 1oqq_B 1xln_A 1xln_B 1xlo_A 1xlo_B 3lb8_C 3lb8_D 000071927|e1oqqB1|221.1.1.12|B:1-106 000071929|e1xloA1|221.1.1.12|A:1-106 000071940|e1xlnA1|221.1.1.12|A:1-106 000071942|e1xlnB1|221.1.1.12|B:1-106 000071949|e1oqqA1|221.1.1.12|A:1-106 000071950|e1xloB1|221.1.1.12|B:1-106 cath|current|1oqqA00/1-106 cath|current|1oqqB00/1-106 cath|current|1xlnA00/1-106 cath|current|1xlnB00/1-106 cath|current|1xloA00/1-106 cath|current|1xloB00/1-106 cath|current|3lb8C00/1-104 cath|current|3lb8D00/1-103 d1oqqa_ d1oqqb_ d1xlna_ d1xlnb_ d1xloa_ d1xlob_ 1oqqA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]