SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000354339|e3ezqC1|110.1.1.2|C:1-115 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000354339|e3ezqC1|110.1.1.2|C:1-115
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily DEATH domain 7.25e-38
Family DEATH domain, DD 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000354339|e3ezqC1|110.1.1.2|C:1-115
Sequence length 115
Sequence
nlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvqllrnwh
qlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslvle
Download sequence
Identical sequences 3ezq_A 3ezq_C 3ezq_E 3ezq_G 3ezq_I 3ezq_K 3ezq_M 3ezq_O 000169846|e3ezqA1|110.1.1.2|A:1-115 000354339|e3ezqC1|110.1.1.2|C:1-115 000354340|e3ezqE1|110.1.1.2|E:1-115 000354341|e3ezqG1|110.1.1.2|G:1-115 000354342|e3ezqI1|110.1.1.2|I:1-115 000354343|e3ezqK1|110.1.1.2|K:1-115 000354344|e3ezqM1|110.1.1.2|M:1-115 000354345|e3ezqO1|110.1.1.2|O:1-115 cath|current|3ezqA00/223-337 cath|current|3ezqC00/223-337 cath|current|3ezqE00/223-337 cath|current|3ezqG00/223-337 cath|current|3ezqI00/223-337 cath|current|3ezqK00/223-337 cath|current|3ezqM00/223-337 cath|current|3ezqO00/223-337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]