SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001209962|e4e9mF3|110.1.1.1|F:23-116 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001209962|e4e9mF3|110.1.1.1|F:23-116
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily DEATH domain 3.58e-20
Family Caspase recruitment domain, CARD 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001209962|e4e9mF3|110.1.1.1|F:23-116
Sequence length 94
Sequence
HPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCACPTQPDKVRKILDLVQ
SKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFS
Download sequence
Identical sequences 001209962|e4e9mF3|110.1.1.1|F:23-116 hso003005347.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]