SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001720191|e2n7zA1|110.1.1.1|A:1-106 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001720191|e2n7zA1|110.1.1.1|A:1-106
Domain Number 1 Region: 3-87
Classification Level Classification E-value
Superfamily DEATH domain 2e-18
Family Caspase recruitment domain, CARD 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001720191|e2n7zA1|110.1.1.1|A:1-106
Sequence length 106
Sequence
GIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDT
TDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKS
Download sequence
Identical sequences 001720191|e2n7zA1|110.1.1.1|A:1-106 2n7z_A 2n83_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]