SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1dqoA00/2-135 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1dqoA00/2-135
Domain Number 1 Region: 3-134
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.58e-37
Family Cysteine rich domain 0.000000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cath|current|1dqoA00/2-135
Sequence length 135
Sequence
ldarqfliynedhkrcvdalsaisvqtatcnpeaesqkfrwvsdsqimsvafklclgvps
ktdwasvtlyacdskseyqkweckndtlfgikgtelyfnygnrqekniklykgsglwsrw
kvygttddlcsrgye
Download sequence
Identical sequences 1dqg_A 1dqo_A cath|current|1dqgA00/2-135 cath|current|1dqoA00/2-135 1dqgA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]