SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1fs1D00/2-140 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1fs1D00/2-140
Domain Number 1 Region: 4-63
Classification Level Classification E-value
Superfamily POZ domain 1.55e-38
Family BTB/POZ domain 0.046
Further Details:      
 
Domain Number 2 Region: 97-141
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 6.08e-37
Family Skp1 dimerisation domain-like 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cath|current|1fs1D00/2-140
Sequence length 141
Sequence
mpsiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
ddppppeddenkekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanm
ikgktpeeirktfnikndfte
Download sequence
Identical sequences 1fs1_B 1fs1_D 1fs2_B 1fs2_D 1fs1B cath|current|1fs1B00/2-140 cath|current|1fs1D00/2-140 cath|current|1fs2B00/2-146 cath|current|1fs2D00/2-146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]