SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1fvsA00/1-72 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1fvsA00/1-72
Domain Number 1 Region: 6-68
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 9.53e-25
Family HMA, heavy metal-associated domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cath|current|1fvsA00/1-72
Sequence length 72
Sequence
arevilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiie
dcgfdceilrds
Download sequence
Identical sequences 000005140|e2ggpB1|304.3.1.7|B:1-72 000064403|e1fvsA1|304.3.1.7|A:1-72 000064404|e1fvqA1|304.3.1.7|A:1-72 cath|current|1fvqA00/1-72 cath|current|1fvsA00/1-72 cath|current|2ggpB00/1-72 2ggpB 1fvq_A 1fvs_A 2ggp_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]