SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1h48A00/0-156 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1h48A00/0-156
Domain Number 1 Region: 3-158
Classification Level Classification E-value
Superfamily IpsF-like 4.83e-116
Family IpsF-like 0.0000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|1h48A00/0-156
Sequence length 161
Sequence
lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
dlgchmddvnvkattteklgftgrgegiaceavallikatk
Download sequence
Identical sequences cath|current|1h47A00/0-156 cath|current|1h47B00/-1-156 cath|current|1h47C00/0-156 cath|current|1h47D00/0-156 cath|current|1h47E00/-1-156 cath|current|1h47F00/0-156 cath|current|1h48A00/0-156 cath|current|1h48B00/-1-156 cath|current|1h48C00/-1-157 cath|current|1h48D00/-1-156 cath|current|1h48E00/0-156 cath|current|1h48F00/-1-157 cath|current|2ao4A00/-1-157 1h47A 1h47_A 1h47_B 1h47_C 1h47_D 1h47_E 1h47_F 1h48_A 1h48_B 1h48_C 1h48_D 1h48_E 1h48_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]