SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1ia5A00/1-339 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1ia5A00/1-339
Domain Number 1 Region: 30-334
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.83e-116
Family Galacturonase 0.000000000674
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cath|current|1ia5A00/1-339
Sequence length 339
Sequence
attctfsgsngassasksktscstivlsnvavpsgttldltklndgthvifsgettfgyk
ewsgplisvsgsdltitgasghsingdgsrwwdgeggnggktkpkffaahsltnsvisgl
kivnspvqvfsvagsdyltlkditidnsdgddngghntdafdigtstyvtisgatvynqd
dcvavnsgeniyfsggycsgghglsigsvggrsdntvknvtfvdstiinsdngvriktni
dttgsvsdvtykditltsiakygivvqqnygdtsstpttgvpitdfvldnvhgsvvssgt
niliscgsgscsdwtwtdvsvsggktsskctnvpsgasc
Download sequence
Identical sequences 1ia5_A 1ib4_A 1ib4_B 1ia5A cath|current|1ia5A00/1-339 cath|current|1ib4A00/1-339 cath|current|1ib4B00/1-339 d1ia5a_ d1ib4a_ d1ib4b_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]