SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1iv2F00/1402-1551 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1iv2F00/1402-1551
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily IpsF-like 5.13e-69
Family IpsF-like 0.00000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|1iv2F00/1402-1551
Sequence length 152
Sequence
mrigygedshrleegrplylcgllipspvgalahsdgdaamhaltdallsayglgdigll
fpdtdprwrgersevflreamrlveargakllqaslvltldrpklgphrkalvdslsrlm
rlpqdrigltfktseglapshvqaravvlldg
Download sequence
Identical sequences 1iv2_A 1iv2_B 1iv2_C 1iv2_D 1iv2_E 1iv2_F 1iv3_A 1iv3_B 1iv3_C 1iv3_D 1iv3_E 1iv3_F 1iv4_A 1iv4_B 1iv4_C 1iv4_D 1iv4_E 1iv4_F 1iv3A cath|current|1iv2A00/2-151 cath|current|1iv2B00/202-351 cath|current|1iv2C00/402-551 cath|current|1iv2D00/1002-1151 cath|current|1iv2E00/1202-1351 cath|current|1iv2F00/1402-1551 cath|current|1iv3A00/2-151 cath|current|1iv3B00/202-351 cath|current|1iv3C00/402-551 cath|current|1iv3D00/1002-1151 cath|current|1iv3E00/1202-1351 cath|current|1iv3F00/1402-1551 cath|current|1iv4A00/2-151 cath|current|1iv4B00/202-351 cath|current|1iv4C00/402-551 cath|current|1iv4D00/1002-1151 cath|current|1iv4E00/1202-1351 cath|current|1iv4F00/1402-1551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]