SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1ptjC00/30-203 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1ptjC00/30-203
Domain Number 1 Region: 2-173
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.25e-144
Family Transhydrogenase domain III (dIII) 0.0000000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|1ptjC00/30-203
Sequence length 174
Sequence
svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
Download sequence
Identical sequences 000099324|e1hzzC1|2003.1.4.6|C:30-203 000099332|e1nm5C1|2003.1.4.6|C:30-203 000099343|e1ptjC1|2003.1.4.6|C:1-174 cath|current|1hzzC00/30-203 cath|current|1nm5C00/30-203 cath|current|1ptjC00/30-203 cath|current|1u28C00/30-203 cath|current|1u2dC00/30-203 cath|current|1u2gC00/30-203 cath|current|2fr8C00/30-203 cath|current|2frdC00/30-203 cath|current|2oo5C00/30-203 cath|current|2oorC00/30-202 d1hzzc_ d1nm5c_ d1ptjc_ d1u28c_ d1u2dc_ d1u2gc_ d2fr8c_ d2oo5c_ 1ptj_C 2oo5_C 2oor_C 2oorC

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]