SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1q08A00/43-136 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1q08A00/43-136
Domain Number 1 Region: 2-87
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.12e-35
Family DNA-binding N-terminal domain of transcription activators 0.0000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|1q08A00/43-136
Sequence length 99
Sequence
sdlqrlkfirharqlgfslesirellsiridpehhtcqeskgivqerlqeveariaelqs
mqrslqrlndaccgtahssvycsilealeqgasgvksgc
Download sequence
Identical sequences cath|current|1q08A00/43-136 cath|current|1q08B00/45-133 cath|current|1q09A00/44-133 cath|current|1q0aA00/44-134 cath|current|1q0aB00/44-132 1q08_A 1q08_B 1q09_A 1q0a_A 1q0a_B 1q08A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]