SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1sr2A00/775-890 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1sr2A00/775-890
Domain Number 1 Region: 26-115
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 2.05e-23
Family Sensor-like histidine kinase YojN, C-terminal domain 0.00000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|1sr2A00/775-890
Sequence length 116
Sequence
mqeavlqlievqlaqeevtesplggdenaqlhasgyyalfvdtvpddvkrlyteaatsdf
aalaqtahrlkgvfamlnlvpgkqlcetlehlirekdvpgiekyisdidsyvksll
Download sequence
Identical sequences 1sr2A 000003723|e1sr2A1|601.3.1.1|A:1-116 cath|current|1sr2A00/775-890 d1sr2a_ 1sr2_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]