SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1w85A00/4-368 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1w85A00/4-368
Domain Number 1 Region: 19-363
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.69e-104
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000000000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|1w85A00/4-368
Sequence length 368
Sequence
gvktfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrild
qrsislnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqafl
fsrghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgd
fyeginfagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdpla
vyaavkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfr
kfleakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqye
iykekesk
Download sequence
Identical sequences cath|current|1w85A00/4-368 cath|current|1w85C00/4-368 cath|current|1w85E00/5-368 cath|current|1w85G00/5-368 1w85_A 1w85_C 1w85_E 1w85_G 1w85A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]