SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|2a1uB00/4-255 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|2a1uB00/4-255
Domain Number 1 Region: 5-251
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.1e-127
Family ETFP subunits 0.00000000755
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|2a1uB00/4-255
Sequence length 255
Sequence
maelrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvke
viavscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlv
llgkqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkveraidggletlrlklpav
vtadlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedppqrtagvkve
ttedlvaklkeigri
Download sequence
Identical sequences 2a1uB 2a1t_S 2a1u_B cath|current|2a1uB00/4-255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]