SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|2dh0B00/1-181 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|2dh0B00/1-181
Domain Number 1 Region: 76-174
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1.88e-26
Family Tetracyclin repressor-like, C-terminal domain 0.00000134
Further Details:      
 
Domain Number 2 Region: 2-72
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000024
Family Tetracyclin repressor-like, N-terminal domain 0.000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|2dh0B00/1-181
Sequence length 183
Sequence
mrtskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhella
ddwdkelrditrdpedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqw
ipdtddlendahkravylvqlaadglfvhdyihddvlskskrqamletilelipselhhh
hhh
Download sequence
Identical sequences 2zozA cath|current|2dh0A00/3-174 cath|current|2dh0B00/1-181 cath|current|2zozA00/3-174 cath|current|2zozB00/1-181 2zoz_A 2zoz_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]