SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|2h6hB00/515-924 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|2h6hB00/515-924
Domain Number 1 Region: 19-419
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.79e-136
Family Protein prenyltransferases 0.000000000000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|2h6hB00/515-924
Sequence length 437
Sequence
maspssftyycppssspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfs
sykfnhlvprlvlqrekhfhylkrglrqltdayecldasrpwlcywilhslelldepipq
ivatdvcqflelcqspeggfgggpgqyphlaptyaavnalciigteeaydiinrekllqy
lyslkqpdgsflmhvggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggig
gvpgmeahggytfcglaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcy
sfwqagllpllhralhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdf
yhtcfclsglsiaqhfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpv
pgfeelkdetsaepatd
Download sequence
Identical sequences 2h6h_B cath|current|2h6hB00/515-924 2h6hB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]