SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|3p87C00/1-256 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|3p87C00/1-256
Domain Number 1 Region: 127-254
Classification Level Classification E-value
Superfamily DNA clamp 6.41e-66
Family DNA polymerase processivity factor 0.00086
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily DNA clamp 1.83e-46
Family DNA polymerase processivity factor 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cath|current|3p87C00/1-256
Sequence length 261
Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
Download sequence
Identical sequences A0A096NVE2 A0A0D9RLR8 A0A1U7TLS4 A0A2K5F434 A0A2K5IFU5 A0A2K5LKH5 A0A2K5SEH2 A0A2K5XHA2 A0A2K6BWI6 A0A2K6F4P7 A0A2K6K7W5 A0A2K6P1M0 F6ZD63 F7GZC8 G1R863 G3QH49 H0XLL4 H2P1A0 H2QJX3 P12004 P61258
ENSGGOP00000001670 gi|33239451|ref|NP_872590.1| gi|4505641|ref|NP_002583.1| ENSOGAP00000017004 ENSPPYP00000012059 1u7bA ENSGGOP00000001670 cath|current|1axcA00/1-255 cath|current|1axcC00/1-255 cath|current|1axcE00/1-255 cath|current|1u76A00/1-257 cath|current|1u76C00/1-257 cath|current|1u76E00/1-259 cath|current|1u7bA00/1-255 cath|current|1ul1A00/1-259 cath|current|1ul1B00/1-258 cath|current|1ul1C00/1-255 cath|current|1vyjA00/1-257 cath|current|1vyjC00/1-257 cath|current|1vyjE00/1-257 cath|current|1vyjG00/1-260 cath|current|1vyjI00/1-257 cath|current|1vyjK00/1-257 cath|current|1vymA00/1-256 cath|current|1vymB00/1-256 cath|current|1vymC00/1-256 cath|current|1w60A00/1-255 cath|current|1w60B00/1-255 cath|current|2zvkA00/1-255 cath|current|2zvkB00/1-254 cath|current|2zvkC00/1-257 cath|current|2zvlA00/1-255 cath|current|2zvlB00/1-255 cath|current|2zvlC00/1-255 cath|current|2zvlD00/1-255 cath|current|2zvlE00/1-255 cath|current|2zvlF00/1-255 cath|current|2zvmA00/1-255 cath|current|2zvmB00/1-255 cath|current|2zvmC00/1-256 cath|current|3p87A00/1-256 cath|current|3p87B00/1-256 cath|current|3p87C00/1-256 cath|current|3p87D00/1-256 cath|current|3p87E00/1-256 cath|current|3p87F00/1-256 cath|current|3tblA00/1-256 cath|current|3tblB00/1-256 cath|current|3tblC00/1-258 cath|current|3vkxA00/1-255 cath|current|3wgwA00/1-255 cath|current|3wgwB00/1-255 9544.ENSMMUP00000017436 9598.ENSPTRP00000022674 9600.ENSPPYP00000012059 9606.ENSP00000368438 ENSP00000368438 ENSP00000368458 Hs4505641___KOG1636 ENSMMUP00000017436 ENSMMUP00000017436 ENSPANP00000017017 ENSOGAP00000017004 ENSCJAP00000039601 ENSNLEP00000009397 ENSCJAP00000039601 ENSNLEP00000009397 ENSPTRP00000022674 ENSPPYP00000012059 1axc_A 1axc_C 1axc_E 1u76_A 1u76_C 1u76_E 1u7b_A 1ul1_A 1ul1_B 1ul1_C 1vyj_A 1vyj_C 1vyj_E 1vyj_G 1vyj_I 1vyj_K 1vym_A 1vym_B 1vym_C 1w60_A 1w60_B 2zvk_A 2zvk_B 2zvk_C 2zvl_A 2zvl_B 2zvl_C 2zvl_D 2zvl_E 2zvl_F 2zvm_A 2zvm_B 2zvm_C 3ja9_A 3ja9_B 3ja9_C 3p87_A 3p87_B 3p87_C 3p87_D 3p87_E 3p87_F 3tbl_A 3tbl_B 3tbl_C 3vkx_A 3wgw_A 3wgw_B 4rjf_A 4rjf_C 4rjf_E 5mlo_A 5mlo_C 5mlo_E 5mlw_A 5mlw_C 5mlw_E 5yd8_X 5yd8_Y 5yd8_Z 6cbi_A 6cbi_B 6cbi_C 6cbi_D 6cbi_E 6cbi_F 6gis_A 6gis_C ENSP00000368438 ENSP00000368458 ENSPTRP00000022674 ENSP00000368438 NP_001253019.1.72884 NP_001274649.1.63531 NP_002583.1.87134 NP_002583.1.92137 NP_872590.1.87134 NP_872590.1.92137 XP_001165515.1.37143 XP_002747376.1.60252 XP_002830101.1.23681 XP_003278038.1.23891 XP_003779348.1.23681 XP_003788079.1.62490 XP_003821389.1.60992 XP_004061823.1.27298 XP_004061824.1.27298 XP_004697906.1.18182 XP_008017132.1.81039 XP_008017137.1.81039 XP_008060989.1.4292 XP_010377235.1.97406 XP_010377236.1.97406 XP_011739513.1.29376 XP_011739514.1.29376 XP_011739515.1.29376 XP_011796417.1.43180 XP_011796418.1.43180 XP_011830701.1.47321 XP_011830709.1.47321 XP_011907529.1.92194 XP_012310820.1.9421 XP_012494726.1.63892 XP_012494727.1.63892 XP_012610659.1.48125 XP_015004853.1.72884 XP_015004854.1.72884 XP_017379489.1.71028 XP_017733441.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]