SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|4kjeA00/6-111 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|4kjeA00/6-111
Domain Number 1 Region: 8-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.2e-28
Family SCOPe 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|4kjeA00/6-111
Sequence length 111
Sequence
MAGTSEAVKKWVNKIIEENIIAVFAKTECPYCIKAISILKGYNLNSHMHVENIEKNPDMA
NIQAYLKELTGKSSVPRIFINKDVVGGCDDLVKENDEGKLKERLQKLGLVN
Download sequence
Identical sequences A0A024VD23 A0A0L7K8U1 A0A2I0BTG5 Q7KXR4 Q9NLB2 W7FQ10
XP_001351139.1.26446 5833.PFC0271c-1 PFC0271c 4hjm_A 4mzb_A 4mzc_A 4n0z_A 4n10_A 4n11_A cath|current|4hjmA00/6-111 cath|current|4kjeA00/6-111 cath|current|4kjfA00/6-111 cath|current|4mzbA00/6-111 cath|current|4mzcA00/6-111 cath|current|4n0zA00/5-111 cath|current|4n10A00/5-111 cath|current|4n11A00/4-111 gi|124504793|ref|XP_001351139.1| gi|15375385|emb|CAB89174.1| gi|27530599|dbj|BAC53982.1| PFHG_01066T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]