SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d1bwea_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1bwea_
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.71e-21
Family 7-Fe ferredoxin 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) d1bwea_
Sequence length 77
Comment d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]}
Sequence
ayvitepcigtkcascvevcpvdcihegedqyyidpdvcidcgaceavcpvsaiyhedfv
peewksyiqknrdffkk
Download sequence
Identical sequences 000067006|e1bweA1|205.1.1.6|A:1-77 000067008|e1bqxA1|205.1.1.6|A:1-77 cath|current|1bqxA00/1-77 cath|current|1bweA00/1-77 d1bqxa_ d1bwea_ 1bweA 1bqx_A 1bwe_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]