SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d1dt4a_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1dt4a_
Domain Number 1 Region: 5-60
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.26e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) d1dt4a_
Sequence length 73
Comment d.51.1.1 (A:) Neuro-oncological ventral antigen 1, nova-1, KH3 {Human (Homo sapiens) [TaxId: 9606]}
Sequence
mkdvveiavpenlvgailgkggktlveyqeltgcriqiskkgeflpgtrnrkvtitgtpa
atqaaqylitqri
Download sequence
Identical sequences 1dt4_A 000070771|e1dt4A1|327.11.2.14|A:1-73 cath|current|1dt4A00/4-76 d1dt4a_ 1dt4A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]