SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d1g3oa_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1g3oa_
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.31e-24
Family 7-Fe ferredoxin 0.00000428
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) d1g3oa_
Sequence length 106
Comment d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}
Sequence
afvvtdncikckytdcveecpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
Download sequence
Identical sequences 1g3oA 000066976|e1g3oA1|205.1.1.3|A:1-106 cath|current|1g3oA00/1-106 d1g3oa_ 1g3o_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]