SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d1go4g_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1go4g_
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 4.32e-34
Family Mitotic arrest deficient-like 1, Mad1 0.00000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) d1go4g_
Sequence length 100
Comment h.1.22.1 (G:) Mitotic arrest deficient-like 1, Mad1 {Human (Homo sapiens) [TaxId: 9606]}
Sequence
ssaeqsflfsreeadtlrlkveelegersrleeekrmleaqlerralqgdydqsrtkvlh
mslnptsvarqrlredhsqlqaecerlrgllramerggtv
Download sequence
Identical sequences 1go4E d1go4g_ 1go4_E 1go4_F 1go4_G 1go4_H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]