SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d1kgma_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1kgma_
Domain Number 1 Region: 1-34
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00000000000146
Family PMP inhibitors 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) d1kgma_
Sequence length 35
Comment g.4.1.1 (A:) Protease inhibitor SGCI {Desert locust (Schistocerca gregaria) [TaxId: 7010]}
Sequence
evtcepgttfkdkcntcrcgsdgksaactlkacpq
Download sequence
Identical sequences d1kgma_ 1kgmA 1kgm_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]