SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d1kvja_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1kvja_
Domain Number 1 Region: 10-73
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 1.76e-32
Family HMA, heavy metal-associated domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) d1kvja_
Sequence length 79
Comment d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}
Sequence
mdpsmgvnsvtisvegmtcnscvwtieqqigkvngvhhikvsleeknatiiydpklqtpk
tlqeaiddmgfdavihnpd
Download sequence
Identical sequences 1kvi_A 1kvj_A 1kvjA cath|current|1kviA00/1-79 cath|current|1kvjA00/1-79 d1kvia_ d1kvja_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]