SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d1nhce_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1nhce_
Domain Number 1 Region: 26-331
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.41e-111
Family Galacturonase 0.000000000424
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) d1nhce_
Sequence length 336
Comment b.80.1.3 (E:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId: 5061]}
Sequence
stctftsaseasesisscsdvvlssievpagetldlsdaadgstitfegttsfgykewkg
plirfggkdltvtmadgavidgdgsrwwdskgtnggktkpkfmyihdvedstfkginikn
tpvqaisvqatnvhlndftidnsdgddngghntdgfdisestgvyisgatvknqddciai
nsgesisftggtcsgghglsigsvggrddntvknvtisdstvsnsangvriktiyketgd
vseitysniqlsgitdygivieqdyengsptgtpstgipitdvtvdgvtgtleddatqvy
ilcgdgscsdwtwsgvdlsggktsdkcenvpsgasc
Download sequence
Identical sequences cath|current|1nhcA00/33-368 cath|current|1nhcB00/33-368 cath|current|1nhcC00/33-368 cath|current|1nhcD00/33-368 cath|current|1nhcE00/33-368 cath|current|1nhcF00/33-368 d1nhca_ d1nhcb_ d1nhcc_ d1nhcd_ d1nhce_ d1nhcf_ 1nhcA 1nhc_A 1nhc_B 1nhc_C 1nhc_D 1nhc_E 1nhc_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]