SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d1pufb_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1pufb_
Domain Number 1 Region: 8-60
Classification Level Classification E-value
Superfamily Homeodomain-like 9.63e-32
Family Homeodomain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) d1pufb_
Sequence length 73
Comment a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]}
Sequence
arrkrrnfnkqateilneyfyshlsnpypseeakeelakkcgitvsqvsnwfgnkriryk
knigkfqeeaniy
Download sequence
Identical sequences 1puf_B 000002459|e1pufB1|101.1.1.10|B:1-73 cath|current|1pufB00/233-305 d1pufb_ 1pufB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]