SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d1usyc_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1usyc_
Domain Number 1 Region: 2-271
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.51e-30
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) d1usyc_
Sequence length 275
Comment d.104.1.1 (C:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]}
Sequence
mdfldfekvfsfyskatkkgfspffvpalekaeepagnffldrkgnlfsiredftktvln
hrkryspesqikvwyadfvyrysgsdlvaeyqlglekvprnslddslevleiivesasef
fegpviveightglyedllkeipkdlhekvlnlidtknlaeieflshmkkidlsrvekii
edsiyrrspehlktmdlplsvredllsassflqekfptvsveidltlartieeycglift
iydtsssrlvaaggeytvngekgvggsiflegktc
Download sequence
Identical sequences 1usy_C 000079586|e1usyC1|314.1.1.12|C:1-275 cath|current|1usyC00/1-275 d1usyc_ 1usyC

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]