SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for d1viha_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1viha_
Domain Number 1 Region: 7-69
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.89e-28
Family Eukaryotic type KH-domain (KH-domain type I) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) d1viha_
Sequence length 71
Comment d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]}
Sequence
inrmdyveinidhkfhrhligksganinrikdqykvsvrippdseksnliriegdpqgvq
qakrellelas
Download sequence
Identical sequences 1vig_A 1vih_A 1vigA 000005923|e1vigA1|327.11.2.1|A:1-71 000070775|e1vihA1|327.11.2.1|A:1-71 cath|current|1vigA00/6-76 cath|current|1vihA00/6-76 d1viga_ d1viha_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]