SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d1wega_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1wega_
Domain Number 1 Region: 3-225
Classification Level Classification E-value
Superfamily DNA-glycosylase 6.46e-79
Family Mismatch glycosylase 0.00000000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) d1wega_
Sequence length 225
Comment a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]}
Sequence
mqasqfsaqvldwydkygrktlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
tagailslslgkhfpildgnvarvlarcyavsgwpgkkevenklwslseqvtpavgverf
nqammdlgamictrskpkcslcplqngciaaannswalypgkkpk
Download sequence
Identical sequences 1kg4A 1kg4_A 1weg_A d1wega_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]