SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d2hi3a_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d2hi3a_
Domain Number 1 Region: 9-66
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000339
Family Homeodomain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) d2hi3a_
Sequence length 73
Comment a.4.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
Sequence
msaqtvsgptedqveileynfnkvnkhpdpttlcliaaeaglteeqtqkwfkqrlaewrr
seglpsecrsvtd
Download sequence
Identical sequences 2hi3A 2hi3_A d2hi3a_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]