SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d2nspa_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d2nspa_
Domain Number 1 Region: 5-339
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.27e-108
Family Pectin methylesterase 0.000000000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) d2nspa_
Sequence length 342
Comment b.80.1.5 (A:) automated matches {Erwinia chrysanthemi [TaxId: 198628]}
Sequence
attynavvsksssdgktfktiadaiasapagstpfvilikngvynerltitrnnlhlkge
srngaviaaataagtlksdgskwgtagsstitisakdfsaqsltirndfdfpanqaksds
dsskikdtqavalyvtksgdrayfkdvslvgyqatlyvsggrsffsdcrisgtvdfifgd
gtalfnncdlvsryradvksgnvsgyltapstninqkyglvitnsrviresdsvpaksyg
lgrpwhptttfsdgryadpnaigqtvflntsmdnhiygwdkmsgkdkngntiwfnpedsr
ffeyksygagatvskdrrqltdaqaaeytqskvlgdwtptlp
Download sequence
Identical sequences 2nsp_A 2nsp_B 2nst_A 2nst_B 2nt6_A 2nt6_B 2nt9_A 2nt9_B 000165524|e2nspA1|207.2.1.14|A:1-342 000327304|e2nspB1|207.2.1.14|B:1-342 000327305|e2nstA1|207.2.1.14|A:1-342 000327306|e2nstB1|207.2.1.14|B:1-342 000327307|e2nt6A1|207.2.1.14|A:1-342 000327308|e2nt6B1|207.2.1.14|B:1-342 000327309|e2nt9A1|207.2.1.14|A:1-342 000327310|e2nt9B1|207.2.1.14|B:1-342 cath|current|2nspA00/25-366 cath|current|2nspB00/25-366 cath|current|2nstA00/25-366 cath|current|2nstB00/25-366 cath|current|2nt6A00/25-366 cath|current|2nt6B00/25-366 cath|current|2nt9A00/25-366 cath|current|2nt9B00/25-366 d2nspa_ d2nspb_ d2nsta_ d2nstb_ d2nt6a_ d2nt6b_ d2nt9a_ d2nt9b_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]